PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000319656
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 823aa    MW: 91683.5 Da    PI: 9.4879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000319656genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.5e-15490536148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT  Ed +l ++vkq+G + W+ Ia+++  gR +kqc++rw+++l
    MDP0000319656 490 KGQWTDGEDRKLMRLVKQYGVRKWAQIAEKLV-GRAGKQCRERWHNHL 536
                      799*****************************.*************97 PP

2Myb_DNA-binding57.23.8e-18542584145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+ +lvda+++ G++ W+ Ia++++ gRt++ +k++w+
    MDP0000319656 542 KDSWTEEEEAILVDAHTEVGNR-WAEIAKRIP-GRTENAIKNHWN 584
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.736485540IPR017930Myb domain
SuperFamilySSF466891.05E-28488583IPR009057Homeodomain-like
SMARTSM007172.1E-14489538IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-26491543IPR009057Homeodomain-like
CDDcd001673.35E-13493536No hitNo description
PfamPF139214.4E-18493550No hitNo description
SMARTSM007177.1E-17541589IPR001005SANT/Myb domain
PROSITE profilePS5129420.927541591IPR017930Myb domain
CDDcd001679.05E-13544587No hitNo description
Gene3DG3DSA:1.10.10.609.3E-21544589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 823 aa     Download sequence    Send to blast
IKKAQKRLLV GDMSSDFXLD QVKGHDSEDP EVGSINGGLH SILPERRAVT LTDRLFRGSR  60
GGHGASVPNG GDEEREHGSA RKSGPLLSGT AYCISSCSMI LLNKVVLSGY NFNAGVSLMF  120
YQNLISTVIV VLLGFSGVVT VEKLNWKLVR VWIPVNVIFI GMLVSGMYSL KYVNIAMVTI  180
LKNVTNILTA LGELYLFRKH QNQKVWTAMF FMVINSTVIV DEIISAISKW HYRYLLRYGR  240
LRMAAFKLRT NRKLLNHFII CANTLYFDSS LYGESWMKQR STQDLDXSTK DVIKLPMFWV  300
VATASGLLGL AISFTSMWFL HQTGPTTYSL VGSLNKIPIS LAGLVLFKVP LSPPNLFSIL  360
FGPPLTAIDR FLWGSHQSQN NASNKDHQKV VSSNGLSGFA SFGGGGAIIS HEAAASWPSN  420
YSATTNHLQE PSFVDEFFVG QGEALMMSWF QEQNPNATGG FREEGRVSER NCKAVGKRAK  480
KGLTAATLIK GQWTDGEDRK LMRLVKQYGV RKWAQIAEKL VGRAGKQCRE RWHNHLRPDI  540
KKDSWTEEEE AILVDAHTEV GNRWAEIAKR IPGRTENAIK NHWNATKRRQ NSRRKNKQTE  600
GKNGNNKKPQ SSILQNYIRS KNLMNNNNSN ISSSTPTSSS TLSHEDPSKT YLNILVTEPS  660
DQSTTSNCCD SPLNLADSLY NDEELVFMQN FFTNNPYNHP QQPSNSTENN VGLIVSPMEA  720
SQNPNMYNFS SSIINPTTTT TTTXTPSPTT PTPXYSDLYL LNGAANSSSY NPNDHHPHLG  780
FYNXNMEYLV SHDHHHHLQA AASASNEGRE MDLIEMVSAS QGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-444885902104MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-444885902104C-Myb DNA-Binding Domain
1msf_C6e-444885902104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356474.10.0PREDICTED: transcriptional activator Myb
TrEMBLM5WL970.0M5WL97_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.12e-56myb domain protein 64